Joined in 2023 
82 
63 About this deal
Pasta dishes offer a versatile canvas for incorporating canned oysters. Prepare a delectable seafood pasta by sautéing garlic, onions, and canned oysters in olive oil, then tossing them with your favorite pasta and a sprinkle of Parmesan cheese. This dish not only showcases the flavor of the oysters but also provides a well-rounded meal. 4. Explore Global Cuisines Alleviation of the Common Cold (*Controversial) - There are conflicting studies as to whether or not zinc supplements can alleviate symptoms of the common cold and shorten its duration. At least one study confirms decreased duration of cold symptoms compared to a control,(10) however, other studies report no effect.(11,12) Since no harm is reported, increasing zinc intake could only help.
Consuming zinc-rich foods is a powerful way to support overall health and well-being. Zinc, an essential mineral, plays a crucial role in numerous physiological processes within the body. From boosting the immune system to promoting wound healing and enhancing cognitive function, zinc offers a wide range of benefits that contribute to optimal health. Let’s explore the specific advantages of zinc and discover examples of other zinc-rich foods to incorporate into your diet. Supporting the Immune System Each bottle contains the goodness of over 60 oysters that are wild-caught from the pristine Atlantic ocean waters in Ireland, making for the most potent oyster extract around. Our process involves slow, gentle convection drying under a low temperature to preserve bioactivity and nutrient integrity. Increase in exercise tolerance, liver glycogen and muscle glycogen, decrease the levels of BUN in male Kumming mice Antioxidant Defense: Zinc acts as an antioxidant, protecting cells from oxidative damage and reducing inflammation.
Oyster Tissues
Fortified Cereals: Some cereals are fortified with zinc, offering a convenient way to increase your intake of this vital mineral.
QAQALLPIASYAGLTVSAPVFAALVTVYGAYALYRYNIRRRENSYQRIRSDHDSHSCANNRGWCRPTCFSHEYTDWFNNDVCGSYRCCRPGRSG (10.7kDa) Conceptualization, Y-HC and SU; formal analysis, SU and SK; investigation, SU and T-JN; data curation, SU and S.K; writing—original draft preparation, SU and SK; writing—review and editing, Y-HC and T-JN; supervision, Y-HC and T-JN; project administration, T-JN; funding acquisition, T-JN. All authors have read and agreed to the published version of the manuscript. Funding
Common questions
Vegetarians - The bio-availability of zinc is higher in meats and thus more easily absorbed. Further, legumes and whole grains contain phytates which bind zinc and inhibit absorption. Vegetarians should aim to eat 50% DV more zinc each day to ensure proper levels. For more vegetarian sources of zinc see the lists of vegetarian zinc foods, high zinc fruits and high zinc vegetables.
Oysters: Oysters are among the richest sources of zinc, with just a few oysters providing a significant portion of the recommended daily intake. A major breakthrough in bone graft substitution using nacre was achieved by Lopez et al. (1992). Atlan et al. (1999) subsequently investigated the interface between bone and nacre in sheep, showing that nacre binds directly to newly formed bone without the need for intervening fibrous tissue. In vitro and in vivo studies have demonstrated that nacre contains molecules capable of activating osteogenic bone marrow cells ( Lamghari et al., 1999). Using proteomics, proteins with osteogenic activity were identified among WSM proteins (WSMPs) from C. gigas nacre. These proteins are important for bone remodeling and biocompatibility ( Oliveira et al., 2012). The effects of alginate hydrogels, including nacre powder, on osteogenic differentiation of human bone marrow mesenchymal stem cells have also been investigated ( Flausse et al., 2013). Inflammation is generally caused by the release of chemicals from tissues and migrating cells, and serves as defense against noxious stimuli and microbial infections. Inflammation promotes rapid tissue repair but also plays a role in diseases such as rheumatoid arthritis, chronic bronchitis, asthma, and cancer ( Hwang et al., 2019). Bacterial endotoxins present in the cell wall of bacteria, such as LPS, activate the mitogen-activated protein kinase (MAPK) pathway, downstream NF-κB, and cyclic AMP-responsive element. This leads to macrophage proliferation and upregulates inducible NO and COX-2 expression ( Choi et al., 2009). COX-2 plays a major role in converting arachidonic acid into prostaglandins, which regulate immune functions. iNOS is regulated by cytokines and transcriptional activation of macrophage cells ( Hwang et al., 2019); elevated levels of iNOS cause NO accumulation and promote the production of cytokines (TNF-α and ILs), among other inflammatory factors ( Mollace et al., 2005).
Whole Grains Deliver Fiber and Key Vitamins and Minerals Like Zinc
Zinc plays many important roles in your overall health. It’s one of the things that your body needs for: Consider Sustainable Practices: Support brands that prioritize sustainability and responsible fishing practices. Look for certifications such as Marine Stewardship Council (MSC) or Best Aquaculture Practices (BAP). ABTS and DPPH radical-scavenging activity oxygen radical absorbance capacity (ORAC) and cellular antioxidant activity (CAA) in a HepG2 cells Harvesting Location: The location from which the oysters are harvested can impact their zinc levels. Oysters sourced from nutrient-rich waters may contain higher concentrations of zinc. This is because zinc is a vital mineral that your body uses in hundreds of ways. Primarily, to nourish and support the immune system. See, the human body needs zinc to activate T lymphocytes (T cells), which help the body control and regulate immune responses.*
Oyster is an important and extensively farmed marine resource with high commercial value ( Cheng et al., 2021; Hao et al., 2021). Oyster aquaculture has been practiced for over 2,000years ( Campbell and Hall, 2018). According to the Food and Agriculture Organization ( FAO, 2018), global oyster production stands at around 6.1 million tons per year, and worldwide, oyster exports increased threefold from 1997 to 2017. Oysters are highly nutritious and possess medicinal value. Oysters have high protein, active polysaccharides, taurine, vitamin, and mineral contents, and are also low in fat ( Guo et al., 2020). Many researchers aim to extract bioactive materials from various oyster parts for biomedical applications. Oyster Species: Different species of oysters may have varying zinc levels. Some varieties, such as Pacific oysters, tend to have higher zinc content compared to others. People with Gastrointestinal and Other Diseases - Gastrointestinal surgery, Crohn's disease, ulcerative colitis, short bowel syndrome and other digestive diseases can all decrease zinc absorption and increase zinc loss from the body.In addition to its physical benefits, zinc is essential for optimal cognitive function. Adequate zinc levels are crucial for neurotransmitter regulation and communication within the brain. This mineral supports memory, learning, and overall cognitive performance. Research suggests that zinc deficiency may be associated with cognitive impairments, including poor memory and reduced attention span. By consuming zinc-rich foods, such as oysters, beef, pumpkin seeds, and fortified cereals, you can support brain health and maintain optimal cognitive function throughout life. Immune System Support: Zinc helps strengthen the immune system, reducing the severity and duration of infections. Inhibits NO production in LPS-induced RAW264.7 cells and PGE2, iNOS and COX-2 expression; Inhibits the inflammatorycytokines (TNF-α, IL-1β, IL-6), repress the nucleartranslocationof phosphorylated nuclear factor-κB and degradation of inhibitor of nuclear factor-κB In addition to loving up your immune system, zinc has myriad documented health benefits. Scientific studies state that zinc may support: Our Oysterzinc's natural cofactors include peptides, amino acids and organic nutrients, making it bioavailable and easy to absorb. You can also enjoy its vitamin B12, iodine, selenium and copper.*
Great Deal 
New Comment